Rabies virus Glycoprotein

Product Overview

• Article Name: Rabies virus Glycoprotein
• Biozol Catalog Number: BYT-ORB246532
• Supplier Catalog Number: orb246532
• Alternative Catalog Number: BYT-ORB246532-1,BYT-ORB246532-100,BYT-ORB246532-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Rabies virus Glycoprotein

Product Description

This Rabies virus Glycoprotein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 65.5 kDa
• UniProt: P03524
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Rabies virus (strain ERA) (RABV)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPD

Application Notes

• Application Notes: Biological Origin: Rabies virus (strain ERA) (RABV). Application Notes: This is His-SUMO-tag protein

Images

Western blot analysis of Glycoprotein G protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.