E.coli Polygalacturonase protein

Product Overview

• Article Name: E.coli Polygalacturonase protein
• Biozol Catalog Number: BYT-ORB246580
• Supplier Catalog Number: orb246580
• Alternative Catalog Number: BYT-ORB246580-1,BYT-ORB246580-100,BYT-ORB246580-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Polygalacturonase, PG, EC 3.2.1.15, Major pollen allergen Cha o 2, Pectinase, allergen Cha o 2

Product Description

This E.coli Polygalacturonase protein spans the amino acid sequence from region 51-514aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 66.5 kDa
• UniProt: Q7M1E7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Chamaecyparis obtusa (Hinoki false-cypress)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SRHDAATVFNVEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANKKFFVNNLVFRGPCQPHLSFKVDGTIVAQPDPARWKNSKIWLQFAQLTDFNLMGTGVIDGQGQQWWAGQCKVVNGRTVCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPRDSPNTDGIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEVSHVHVNRAKFI

Application Notes

• Application Notes: Biological Origin: Chamaecyparis obtusa (Hinoki false-cypress). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chamaecyparis obtusa (Hinoki false-cypress).