E.coli pstS1 protein

Catalog Number: BYT-ORB246701
Article Name: E.coli pstS1 protein
Biozol Catalog Number: BYT-ORB246701
Supplier Catalog Number: orb246701
Alternative Catalog Number: BYT-ORB246701-1,BYT-ORB246701-100,BYT-ORB246701-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: pstS1 phoS1
This E.coli pstS1 protein spans the amino acid sequence from region 24-373aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 39.8 kDa
UniProt: P9WGU0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDA
Application Notes: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) pstS1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) pstS1.