Human LGR5 protein
Catalog Number:
BYT-ORB246757
- Images (3)
| Article Name: | Human LGR5 protein |
| Biozol Catalog Number: | BYT-ORB246757 |
| Supplier Catalog Number: | orb246757 |
| Alternative Catalog Number: | BYT-ORB246757-1,BYT-ORB246757-100,BYT-ORB246757-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | LGR5 |
| This Human LGR5 protein spans the amino acid sequence from region 22-561aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 62.4 kDa |
| UniProt: | O75473 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKA |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein |



