Mouse Plbd2 protein

Catalog Number: BYT-ORB246927
Article Name: Mouse Plbd2 protein
Biozol Catalog Number: BYT-ORB246927
Supplier Catalog Number: orb246927
Alternative Catalog Number: BYT-ORB246927-1,BYT-ORB246927-100,BYT-ORB246927-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 66.3KDA protein76KDA protein , p76LAMA-like protein 2Lamina ancestor homolog 2, Phospholipase B domain-containing protein 2
This Mouse Plbd2 protein spans the amino acid sequence from region 47-594aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 65.9 kDa
UniProt: Q3TCN2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length protein of HIS and expression region is 47-594aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Mus musculus (Mouse) Plbd2.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Mus musculus (Mouse) Plbd2.