Mouse Plbd2 protein

Product Overview

• Article Name: Mouse Plbd2 protein
• Biozol Catalog Number: BYT-ORB246927
• Supplier Catalog Number: orb246927
• Alternative Catalog Number: BYT-ORB246927-1,BYT-ORB246927-100,BYT-ORB246927-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 66.3KDA protein76KDA protein , p76LAMA-like protein 2Lamina ancestor homolog 2, Phospholipase B domain-containing protein 2

Product Description

This Mouse Plbd2 protein spans the amino acid sequence from region 47-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 65.9 kDa
• UniProt: Q3TCN2
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNN

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length protein of HIS and expression region is 47-594aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Mus musculus (Mouse) Plbd2.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Mus musculus (Mouse) Plbd2.