SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (APC)
Catalog Number:
BYT-ORB2602776
| Article Name: |
SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (APC) |
| Biozol Catalog Number: |
BYT-ORB2602776 |
| Supplier Catalog Number: |
orb2602776 |
| Alternative Catalog Number: |
BYT-ORB2602776-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
FC |
| Species Reactivity: |
Human |
| Immunogen: |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
| Conjugation: |
APC |
| Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2 |
| Anti-SARS-CoV-2 NSP8 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
16693 Da |
| UniProt: |
P0DTD1 |
| Buffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Form: |
Liquid |
| Target: |
Endothelin-1, Endothelin-2, Endothelin-3 |
| Application Dilute: |
Flow Cytometry, Optimal dilutions should be determined by end users. |