SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (Biotin)

Catalog Number: BYT-ORB2602780
Article Name: SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody (Biotin)
Biozol Catalog Number: BYT-ORB2602780
Supplier Catalog Number: orb2602780
Alternative Catalog Number: BYT-ORB2602780-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC, WB
Species Reactivity: Human
Immunogen: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Conjugation: Biotin
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2
Anti-SARS-CoV-2 NSP8 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Molecular Weight: 16693 Da
UniProt: P0DTD1
Buffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Form: Liquid
Target: Platelet-derived growth factor subunit B,Platelet-derived growth factor subunit A
Application Dilute: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.