SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (HRP)

Product Overview

• Article Name: SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (HRP)
• Biozol Catalog Number: BYT-ORB2602826
• Supplier Catalog Number: orb2602826
• Alternative Catalog Number: BYT-ORB2602826-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC, WB
• Species Reactivity: Human
• Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
• Conjugation: HRP
• Alternative Names: ORF8 protein, ORF8, Non-structural protein 8, ns8, sars-cov-2

Product Description

Anti-SARS-CoV-2 ORF8 Antibody. Tested in ELISA applications. This antibody reacts with Human.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 16693 Da
• UniProt: P0DTC8
• Buffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
• Form: Liquid
• Target: ORF8 protein

Application Notes

• Application Dilute: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.