Anti-SARS-CoV-2 ORF8 Antibody, Cy3, Rabbit, Polyclonal

Catalog Number: BYT-ORB2602828
Article Name: Anti-SARS-CoV-2 ORF8 Antibody, Cy3, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2602828
Supplier Catalog Number: orb2602828
Alternative Catalog Number: BYT-ORB2602828-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Conjugation: Cy3
Alternative Names: ORF8 protein, ORF8, Non-structural protein 8, ns8
Anti-SARS-CoV-2 ORF8 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTC8
Form: Lyophilized
Application Notes: Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml