SARS-CoV-2 NSP9 Antibody, PE, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2602838
| Article Name: |
SARS-CoV-2 NSP9 Antibody, PE, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2602838 |
| Supplier Catalog Number: |
orb2602838 |
| Alternative Catalog Number: |
BYT-ORB2602838-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Human |
| Immunogen: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Conjugation: |
PE |
| Alternative Names: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9, sars-cov-2 |
| Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Clonality: |
Polyclonal |
| Concentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molecular Weight: |
140 kDa, 130 kDa, 110 kDa |
| UniProt: |
P0DTD1 |
| Form: |
Lyophilized |
| Application Notes: |
Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |