Anti-SARS-CoV-2 NSP9 Antibody, FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2602841
Article Name: Anti-SARS-CoV-2 NSP9 Antibody, FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2602841
Supplier Catalog Number: orb2602841
Alternative Catalog Number: BYT-ORB2602841-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Conjugation: FITC
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9
Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTD1
Form: Lyophilized
Application Notes: Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml