Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)
Catalog Number:
BYT-ORB2658573
- Images (3)
| Article Name: | Recombinant Human Claudin-6 (CLDN6)-Detergent (Active) |
| Biozol Catalog Number: | BYT-ORB2658573 |
| Supplier Catalog Number: | orb2658573 |
| Alternative Catalog Number: | BYT-ORB2658573-20,BYT-ORB2658573-100,BYT-ORB2658573-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | UNQ757, PRO1488 |
| This Recombinant Human Claudin-6(CLDN6)-Detergent (Active) spans the amino acid sequence from region 2-220aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 27.7 kDa |
| UniProt: | P56747 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered DDM/CHS, 50 mM HEPES, 150 mM NaCl, 6% Trehalose, pH 7.5. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



