Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)

Catalog Number: BYT-ORB2658573
Article Name: Recombinant Human Claudin-6 (CLDN6)-Detergent (Active)
Biozol Catalog Number: BYT-ORB2658573
Supplier Catalog Number: orb2658573
Alternative Catalog Number: BYT-ORB2658573-20,BYT-ORB2658573-100,BYT-ORB2658573-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: UNQ757, PRO1488
This Recombinant Human Claudin-6(CLDN6)-Detergent (Active) spans the amino acid sequence from region 2-220aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.7 kDa
UniProt: P56747
Buffer: Lyophilized from a 0.2 µm sterile filtered DDM/CHS, 50 mM HEPES, 150 mM NaCl, 6% Trehalose, pH 7.5.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 µg/ml on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.
Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length Protein with an affinity constant of 5.43 nM as detected by MetaSPR Assay (in presence of DDM/CHS) (WeSPRTM200).