Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)

Catalog Number: BYT-ORB2658695
Article Name: Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)
Biozol Catalog Number: BYT-ORB2658695
Supplier Catalog Number: orb2658695
Alternative Catalog Number: BYT-ORB2658695-100,BYT-ORB2658695-20,BYT-ORB2658695-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Activin receptor type-2B,EC: 2.7.11.30, Activin receptor type IIB (ACTR-IIB), Acvr2b
This Recombinant Mouse Activin receptor type-2B (Acvr2b), partial spans the amino acid sequence from region 19-137aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.2 kDa
UniProt: P27040
Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 µg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.560-4.235 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 µg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.560-4.235 ng/mL.
The purity of ACVR2B was greater than 90% as determined by SEC-HPLC