Recombinant Macaca fascicularis G-protein coupled receptor 20 (GPR20)-VLPs (Active)

Product Overview

• Article Name: Recombinant Macaca fascicularis G-protein coupled receptor 20 (GPR20)-VLPs (Active)
• Biozol Catalog Number: BYT-ORB2658865
• Supplier Catalog Number: orb2658865
• Alternative Catalog Number: BYT-ORB2658865-20,BYT-ORB2658865-100,BYT-ORB2658865-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

This Recombinant Macaca fascicularis G protein-coupled receptor 20 (GPR20)-VLPs (Active) spans the amino acid sequence from region 1-359aa. Purity: The purity information is not available for VLPs proteins.

Product Properties

• Molecular Weight: 40.2 kDa
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Purity: The purity information is not available for VLPs proteins.
• Form: Lyophilized powder
• Sequence: MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFT

Application Notes

• Application Notes: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 µg/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 3.549 - 6.542 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Images

Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GPR20 at 10 µg/ml can bind Anti-GPR20 recombinant antibody. The EC50 is 3.549 - 6.542 ng/mL.The VLPs is negative control.

The purity of VLPs was greater than 95% as determined by SEC-HPLC