Recombinant Birmingham IncP-alpha plasmid Upf32.8 protein (upf32.8)

Catalog Number: BYT-ORB2659521
Article Name: Recombinant Birmingham IncP-alpha plasmid Upf32.8 protein (upf32.8)
Biozol Catalog Number: BYT-ORB2659521
Supplier Catalog Number: orb2659521
Alternative Catalog Number: BYT-ORB2659521-20, BYT-ORB2659521-100
Manufacturer: Biorbyt
Category: Molekularbiologie
Recombinant Birmingham IncP-alpha plasmid Upf32.8 protein (upf32.8)
Molecular Weight: 25.0 kDa
UniProt: A6H957
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Birmingham IncP-alpha plasmid
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MYVIACGIVAGLAAAVALLGFTPMMEALAAGERRKALAQWTRTMFLVLLPVVLMCAPIGSSIYDAVQADAGKPIAFHNGRITVVMALVGSLAVVLVAAARAVVNRKHASFWFVGWVMASVLAGGVGAIASAKQLAFLGEHSGMVAFGFFRDQVKDMHCDADVILARWDEKANSPVVYRCPKAYLLNRFASAPFVPWPDYTEGESEDLGRALAAALRDAKR
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.