Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008815
• Supplier Catalog Number: orb3008815
• Alternative Catalog Number: BYT-ORB3008815-1, BYT-ORB3008815-100, BYT-ORB3008815-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase polypeptide VIa-heart, COXVIAH, Cytochrome c oxidase subunit VIA-muscle, COX VIa-M, COX6A2 COX6A COX6AH

Product Description

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial, Biotinylated spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q02221
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)