Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated

Catalog Number: BYT-ORB3008823
Article Name: Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008823
Supplier Catalog Number: orb3008823
Alternative Catalog Number: BYT-ORB3008823-1, BYT-ORB3008823-100, BYT-ORB3008823-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sodium-dependent dopamine transporter, DA transporter, DAT, Solute carrier family 6 member 3, SLC6A3 DAT1
This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01959
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP
Application Notes: Biological Origin: Homo sapiens (Human)