Recombinant Human DNA-binding protein SATB1 (SATB1), Biotinylated

Catalog Number: BYT-ORB3008827
Article Name: Recombinant Human DNA-binding protein SATB1 (SATB1), Biotinylated
Biozol Catalog Number: BYT-ORB3008827
Supplier Catalog Number: orb3008827
Alternative Catalog Number: BYT-ORB3008827-1, BYT-ORB3008827-100, BYT-ORB3008827-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DNA-binding protein SATB1, Special AT-rich sequence-binding protein 1, SATB1
This Recombinant Human DNA-binding protein SATB1 (SATB1), Biotinylated spans the amino acid sequence from region 1-763. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01826
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMMVEMDS
Application Notes: Biological Origin: Homo sapiens (Human)