Recombinant Human Interleukin-1 receptor-like 1 (ILRL1), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Interleukin-1 receptor-like 1 (ILRL1), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008834
• Supplier Catalog Number: orb3008834
• Alternative Catalog Number: BYT-ORB3008834-1, BYT-ORB3008834-100, BYT-ORB3008834-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Interleukin-1 receptor-like 1, EC 3.2.2.6, Protein ST2, IL1RL1 DER4 ST2 T1

Product Description

This Recombinant Human Interleukin-1 receptor-like 1 (ILRL1), partial, Biotinylated spans the amino acid sequence from region 19-328. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01638
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)