Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial, Biotinylated

Catalog Number: BYT-ORB3008841
Article Name: Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008841
Supplier Catalog Number: orb3008841
Alternative Catalog Number: BYT-ORB3008841-1, BYT-ORB3008841-100, BYT-ORB3008841-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Amyloid-beta A4 precursor protein-binding family A member 1, Adapter protein X11alpha, Neuron-specific X11 protein, Neuronal Munc18-1-interacting protein 1, Mint-1, APBA1 MINT1 X11
This Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial, Biotinylated spans the amino acid sequence from region 457-643. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q02410
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYND
Application Notes: Biological Origin: Homo sapiens (Human)