Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008842
• Supplier Catalog Number: orb3008842
• Alternative Catalog Number: BYT-ORB3008842-1, BYT-ORB3008842-100, BYT-ORB3008842-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: High affinity immunoglobulin epsilon receptor subunit beta, FcERI, Fc epsilon receptor I beta-chain, IgE Fc receptor subunit beta, Membrane-spanning 4-domains subfamily A member 2, MS4A2 APY FCER1B IGER

Product Description

This Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (FCERB), partial, Biotinylated spans the amino acid sequence from region 151-180. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q01362
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: NLKKSLAYIHIHSCQKFFETKCFMASFSTE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)