Recombinant Human Protein SET (SET), Biotinylated

Catalog Number: BYT-ORB3008847
Article Name: Recombinant Human Protein SET (SET), Biotinylated
Biozol Catalog Number: BYT-ORB3008847
Supplier Catalog Number: orb3008847
Alternative Catalog Number: BYT-ORB3008847-1, BYT-ORB3008847-100, BYT-ORB3008847-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, IGAAD, PHAPII, Phosphatase 2A inhibitor I2PP2A, I-2PP2A, Template-activating factor I, TAF-I, SET
This Recombinant Human Protein SET (SET), Biotinylated spans the amino acid sequence from region 2-290. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01105
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEE
Application Notes: Biological Origin: Homo sapiens (Human)