Recombinant Human Nucleolysin TIAR (TIAR), Biotinylated

Catalog Number: BYT-ORB3008849
Article Name: Recombinant Human Nucleolysin TIAR (TIAR), Biotinylated
Biozol Catalog Number: BYT-ORB3008849
Supplier Catalog Number: orb3008849
Alternative Catalog Number: BYT-ORB3008849-1, BYT-ORB3008849-100, BYT-ORB3008849-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nucleolysin TIAR, TIA-1-related protein, TIAL1
This Recombinant Human Nucleolysin TIAR (TIAR), Biotinylated spans the amino acid sequence from region 1-375. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q01085
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAH
Application Notes: Biological Origin: Homo sapiens (Human)