Recombinant Human Perilipin-5 (PLIN5), Biotinylated

Catalog Number: BYT-ORB3008853
Article Name: Recombinant Human Perilipin-5 (PLIN5), Biotinylated
Biozol Catalog Number: BYT-ORB3008853
Supplier Catalog Number: orb3008853
Alternative Catalog Number: BYT-ORB3008853-1, BYT-ORB3008853-100, BYT-ORB3008853-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Perilipin-5, Lipid storage droplet protein 5, PLIN5 LSDP5 OXPAT PAT-1
This Recombinant Human Perilipin-5 (PLIN5), Biotinylated spans the amino acid sequence from region 1-463. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00G26
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLELIDHMQCGVTPTAPAC
Application Notes: Biological Origin: Homo sapiens (Human)