Recombinant Human Interferon regulatory factor 9 (IRF9), Biotinylated

Product Overview

• Article Name: Recombinant Human Interferon regulatory factor 9 (IRF9), Biotinylated
• Biozol Catalog Number: BYT-ORB3008855
• Supplier Catalog Number: orb3008855
• Alternative Catalog Number: BYT-ORB3008855-1, BYT-ORB3008855-100, BYT-ORB3008855-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Interferon regulatory factor 9, IRF-9, IFN-alpha-responsive transcription factor subunit, ISGF3 p48 subunit, Interferon-stimulated gene factor 3 gamma, ISGF-3 gamma, Transcriptional regulator ISGF3 subunit gamma, IRF9 ISGF3G

Product Description

This Recombinant Human Interferon regulatory factor 9 (IRF9), Biotinylated spans the amino acid sequence from region 1-393. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00978
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSME

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)