Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008863
• Supplier Catalog Number: orb3008863
• Alternative Catalog Number: BYT-ORB3008863-1, BYT-ORB3008863-100, BYT-ORB3008863-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2, EC 3.1.4.11, Phosphoinositide phospholipase C-beta-2, Phospholipase C-beta-2, PLC-beta-2, PLCB2

Product Description

This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial, Biotinylated spans the amino acid sequence from region 312-463. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00722
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: HDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKMAEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)