Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial, Biotinylated

Catalog Number: BYT-ORB3008864
Article Name: Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008864
Supplier Catalog Number: orb3008864
Alternative Catalog Number: BYT-ORB3008864-1, BYT-ORB3008864-100, BYT-ORB3008864-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nuclear factor NF-kappa-B p100 subunit, DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, Oncogene Lyt-10, Lyt10, [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] NFKB2 LYT10
This Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial, Biotinylated spans the amino acid sequence from region 38-343. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00653
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTP
Application Notes: Biological Origin: Homo sapiens (Human)