Recombinant Human Cyclin-dependent kinase 17 (CDK17), Biotinylated

Catalog Number: BYT-ORB3008867
Article Name: Recombinant Human Cyclin-dependent kinase 17 (CDK17), Biotinylated
Biozol Catalog Number: BYT-ORB3008867
Supplier Catalog Number: orb3008867
Alternative Catalog Number: BYT-ORB3008867-1, BYT-ORB3008867-100, BYT-ORB3008867-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cyclin-dependent kinase 17, EC 2.7.11.22, Cell division protein kinase 17, PCTAIRE-motif protein kinase 2, Serine/threonine-protein kinase PCTAIRE-2, CDK17 PCTAIRE2 PCTK2
This Recombinant Human Cyclin-dependent kinase 17 (CDK17), Biotinylated spans the amino acid sequence from region 1-523. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: Q00537
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHD
Application Notes: Biological Origin: Homo sapiens (Human)