Recombinant Human Cyclin-dependent kinase-like 1 (CDKL1), Biotinylated

Product Overview

• Article Name: Recombinant Human Cyclin-dependent kinase-like 1 (CDKL1), Biotinylated
• Biozol Catalog Number: BYT-ORB3008869
• Supplier Catalog Number: orb3008869
• Alternative Catalog Number: BYT-ORB3008869-1, BYT-ORB3008869-100, BYT-ORB3008869-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cyclin-dependent kinase-like 1, EC 2.7.11.22, Protein kinase p42 KKIALRE, Serine/threonine-protein kinase KKIALRE, CDKL1

Product Description

This Recombinant Human Cyclin-dependent kinase-like 1 (CDKL1), Biotinylated spans the amino acid sequence from region 1-357. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: Q00532
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPN

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)