Recombinant Human Collagen alpha-4(IV) chain (CO4A4), partial, Biotinylated

Catalog Number: BYT-ORB3008879
Article Name: Recombinant Human Collagen alpha-4(IV) chain (CO4A4), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008879
Supplier Catalog Number: orb3008879
Alternative Catalog Number: BYT-ORB3008879-1, BYT-ORB3008879-100, BYT-ORB3008879-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Collagen alpha-4(IV, chain COL4A4
This Recombinant Human Collagen alpha-4(IV) chain (CO4A4), partial, Biotinylated spans the amino acid sequence from region 1465-1690. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P53420
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIRPYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Application Notes: Biological Origin: Homo sapiens (Human)