Recombinant Human Cone cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (PDE6C), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Cone cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (PDE6C), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008880
• Supplier Catalog Number: orb3008880
• Alternative Catalog Number: BYT-ORB3008880-1, BYT-ORB3008880-100, BYT-ORB3008880-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cone cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha, EC 3.1.4.35, cGMP phosphodiesterase 6C, PDE6C PDEA2

Product Description

This Recombinant Human Cone cGMP-specific 3,5-cyclic phosphodiesterase subunit alpha (PDE6C), partial, Biotinylated spans the amino acid sequence from region 486-819. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P51160
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKVPVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMTACDLSAITKPWEVQSQVALM

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)