Recombinant Human Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta (PDE6B), partial, Biotinylated

Catalog Number: BYT-ORB3008884
Article Name: Recombinant Human Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta (PDE6B), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008884
Supplier Catalog Number: orb3008884
Alternative Catalog Number: BYT-ORB3008884-1, BYT-ORB3008884-100, BYT-ORB3008884-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta, GMP-PDE beta, EC 3.1.4.35, PDE6B PDEB
This Recombinant Human Rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta (PDE6B), partial, Biotinylated spans the amino acid sequence from region 481-814. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P35913
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVLVRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLMDIAIIATDLALYFKKRAMFQKIVDESKNYQDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWEVQSKVALL
Application Notes: Biological Origin: Homo sapiens (Human)