Recombinant Human Pro-adrenomedullin (ADML), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human Pro-adrenomedullin (ADML), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008886
• Supplier Catalog Number: orb3008886
• Alternative Catalog Number: BYT-ORB3008886-1, BYT-ORB3008886-100, BYT-ORB3008886-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Pro-adrenomedullin [Cleaved into: Adrenomedullin, AM, Proadrenomedullin N-20 terminal peptide, ProAM N-terminal 20 peptide, PAMP, ProAM-N20] ADM AM

Product Description

This Recombinant Human Pro-adrenomedullin (ADML), partial, Biotinylated spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P35318
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)