Recombinant Human Inosine-5-monophosphate dehydrogenase 1 (IMDH1), Biotinylated

Catalog Number: BYT-ORB3008893
Article Name: Recombinant Human Inosine-5-monophosphate dehydrogenase 1 (IMDH1), Biotinylated
Biozol Catalog Number: BYT-ORB3008893
Supplier Catalog Number: orb3008893
Alternative Catalog Number: BYT-ORB3008893-1, BYT-ORB3008893-100, BYT-ORB3008893-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Inosine-5-monophosphate dehydrogenase 1, IMP dehydrogenase 1, IMPD 1, IMPDH 1, EC 1.1.1.205, IMPDH-I, IMPDH1 IMPD1
This Recombinant Human Inosine-5-monophosphate dehydrogenase 1 (IMDH1), Biotinylated spans the amino acid sequence from region 2-514. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P20839
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDD
Application Notes: Biological Origin: Homo sapiens (Human)