Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial, Biotinylated

Catalog Number: BYT-ORB3008904
Article Name: Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008904
Supplier Catalog Number: orb3008904
Alternative Catalog Number: BYT-ORB3008904-1, BYT-ORB3008904-100, BYT-ORB3008904-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Glycogen phosphorylase, muscle form, EC 2.4.1.1, Myophosphorylase, PYGM
This Recombinant Human Glycogen phosphorylase, muscle form (PYGM), partial, Biotinylated spans the amino acid sequence from region 2-501. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P11217
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLK
Application Notes: Biological Origin: Homo sapiens (Human)