Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated

Product Overview

• Article Name: Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated
• Biozol Catalog Number: BYT-ORB3008907
• Supplier Catalog Number: orb3008907
• Alternative Catalog Number: BYT-ORB3008907-1, BYT-ORB3008907-100, BYT-ORB3008907-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Alpha-amylase 1A, EC 3.2.1.1, 1,4-alpha-D-glucan glucanohydrolase 1, Salivary alpha-amylase, AMY1A AMY1

Product Description

This Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DUB6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)