Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated

Catalog Number: BYT-ORB3008911
Article Name: Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated
Biozol Catalog Number: BYT-ORB3008911
Supplier Catalog Number: orb3008911
Alternative Catalog Number: BYT-ORB3008911-1, BYT-ORB3008911-100, BYT-ORB3008911-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Alpha-amylase 1B, EC 3.2.1.1, AMY1B AMY1
This Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTE7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTE
Application Notes: Biological Origin: Homo sapiens (Human)