Recombinant Human UDP-glucuronosyltransferase 2A2 (UD2A2), partial, Biotinylated

Catalog Number: BYT-ORB3008912
Article Name: Recombinant Human UDP-glucuronosyltransferase 2A2 (UD2A2), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008912
Supplier Catalog Number: orb3008912
Alternative Catalog Number: BYT-ORB3008912-1, BYT-ORB3008912-100, BYT-ORB3008912-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: UDP-glucuronosyltransferase 2A2, UDPGT 2A2, EC 2.4.1.17, UGT2A2
This Recombinant Human UDP-glucuronosyltransferase 2A2 (UD2A2), partial, Biotinylated spans the amino acid sequence from region 37-500. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTE5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TDGSHWLNIKIILEELIQRNHNVTVLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKELGKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWNSYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKP
Application Notes: Biological Origin: Homo sapiens (Human)