Recombinant Human UDP-glucuronosyltransferase 2A1 (UD2A1), partial, Biotinylated

Catalog Number: BYT-ORB3008913
Article Name: Recombinant Human UDP-glucuronosyltransferase 2A1 (UD2A1), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008913
Supplier Catalog Number: orb3008913
Alternative Catalog Number: BYT-ORB3008913-1, BYT-ORB3008913-100, BYT-ORB3008913-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: UDP-glucuronosyltransferase 2A1, UDPGT 2A1, UGT2A1, EC 2.4.1.17, UGT2A1
This Recombinant Human UDP-glucuronosyltransferase 2A1 (UD2A1), partial, Biotinylated spans the amino acid sequence from region 21-491. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTE4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGGLLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCS
Application Notes: Biological Origin: Homo sapiens (Human)