Recombinant Human M1-specific T cell receptor beta chain (TRBR1), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human M1-specific T cell receptor beta chain (TRBR1), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008914
• Supplier Catalog Number: orb3008914
• Alternative Catalog Number: BYT-ORB3008914-1, BYT-ORB3008914-100, BYT-ORB3008914-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: M1-specific T cell receptor beta chain, TR beta chain TRBV19*01J2S7*01C*02, TRB

Product Description

This Recombinant Human M1-specific T cell receptor beta chain (TRBR1), partial, Biotinylated spans the amino acid sequence from region 22-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DSE2
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIRSSYEQYFGPGTRLTVTEDLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)