Recombinant Human Tubulin alpha-3C chain (TBA3C), Biotinylated

Product Overview

• Article Name: Recombinant Human Tubulin alpha-3C chain (TBA3C), Biotinylated
• Biozol Catalog Number: BYT-ORB3008920
• Supplier Catalog Number: orb3008920
• Alternative Catalog Number: BYT-ORB3008920-1, BYT-ORB3008920-100, BYT-ORB3008920-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Tubulin alpha-3C chain, EC 3.6.5.-, Alpha-tubulin 2, Alpha-tubulin 3C, Tubulin alpha-2 chain, [Cleaved into: Detyrosinated tubulin alpha-3C chain] TUBA3C TUBA2

Product Description

This Recombinant Human Tubulin alpha-3C chain (TBA3C), Biotinylated spans the amino acid sequence from region 1-450. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DPH7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)