Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2), Biotinylated

Catalog Number: BYT-ORB3008926
Article Name: Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2), Biotinylated
Biozol Catalog Number: BYT-ORB3008926
Supplier Catalog Number: orb3008926
Alternative Catalog Number: BYT-ORB3008926-1, BYT-ORB3008926-100, BYT-ORB3008926-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Secreted Ly-6/uPAR domain-containing protein 2, Secreted LY6/PLAUR domain-containing protein 2, Secreted Ly-6/uPAR-related protein 2, SLURP-2, SLURP2
This Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2), Biotinylated spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP57
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Application Notes: Biological Origin: Homo sapiens (Human)