Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated

Catalog Number: BYT-ORB3008930
Article Name: Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated
Biozol Catalog Number: BYT-ORB3008930
Supplier Catalog Number: orb3008930
Alternative Catalog Number: BYT-ORB3008930-1, BYT-ORB3008930-100, BYT-ORB3008930-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Immunoglobulin lambda constant 2, Ig lambda chain C region Kern, Ig lambda chain C region NIG-64, Ig lambda chain C region SH, Ig lambda chain C region X, Ig lambda-2 chain C region, IGLC2
This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DOY2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Application Notes: Biological Origin: Homo sapiens (Human)