Recombinant Human Golgin subfamily A member 6-like protein 24 (GG6LX), partial

Catalog Number: BYT-ORB3009117
Article Name: Recombinant Human Golgin subfamily A member 6-like protein 24 (GG6LX), partial
Biozol Catalog Number: BYT-ORB3009117
Supplier Catalog Number: orb3009117
Alternative Catalog Number: BYT-ORB3009117-1, BYT-ORB3009117-100, BYT-ORB3009117-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Golgin subfamily A member 6-like protein 24 GOLGA6L24
This Recombinant Human Golgin subfamily A member 6-like protein 24 (GG6LX), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DX00
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVQTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADH
Application Notes: Biological Origin: Homo sapiens (Human)