Recombinant Human Speedy protein E15 (SPD15)

Catalog Number: BYT-ORB3009131
Article Name: Recombinant Human Speedy protein E15 (SPD15)
Biozol Catalog Number: BYT-ORB3009131
Supplier Catalog Number: orb3009131
Alternative Catalog Number: BYT-ORB3009131-1, BYT-ORB3009131-100, BYT-ORB3009131-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Speedy protein E15 SPDYE15
This Recombinant Human Speedy protein E15 (SPD15) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DUD4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHW
Application Notes: Biological Origin: Homo sapiens (Human)