Recombinant Human Zinc finger CCCH domain-containing protein 11C (ZC11C), partial

Product Overview

• Article Name: Recombinant Human Zinc finger CCCH domain-containing protein 11C (ZC11C), partial
• Biozol Catalog Number: BYT-ORB3009141
• Supplier Catalog Number: orb3009141
• Alternative Catalog Number: BYT-ORB3009141-1, BYT-ORB3009141-100, BYT-ORB3009141-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Zinc finger CCCH domain-containing protein 11C ZC3H11C

Product Description

This Recombinant Human Zinc finger CCCH domain-containing protein 11C (ZC11C), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DQW0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRRVCRFRHMEIDKKRSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKSVLPTVPESPEEEVKASQLSVQQNKLSVQSNPSPQLRSVMKVESSENVPSPKHPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECLHFGIKTLEEIKSKKMKEKSEEQGEGSSGVSSLLLHPEPVPGPEKE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)