Recombinant Human Centromere protein V-like protein 2 (CENL2)

Catalog Number: BYT-ORB3009144
Article Name: Recombinant Human Centromere protein V-like protein 2 (CENL2)
Biozol Catalog Number: BYT-ORB3009144
Supplier Catalog Number: orb3009144
Alternative Catalog Number: BYT-ORB3009144-1, BYT-ORB3009144-100, BYT-ORB3009144-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Centromere protein V-like protein 2, Centromere protein V pseudogene 2, CENPVL2 CENPVP2
This Recombinant Human Centromere protein V-like protein 2 (CENL2) spans the amino acid sequence from region 1-272. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPI3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGRVRNRATAQRRRRKRPGDPPAACAAIAVTGASRAQCPRVQVGVGSHAAAKRWLGRWRRKRRWRRVRKAGPRDLLPSAPTPDPPGPAPSPKDLDLGAQRERWETFRKLRGLSCEGAAKVLLDTFEYPGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGAESIVTYRSNTHPALHSFCSRCGVQSFHAAVSDPRVYGVAPHCLDEGTVRSVVIEEVGGGDPGEEAAEEHKAI
Application Notes: Biological Origin: Homo sapiens (Human)