Recombinant Human Zinc finger protein 723 (ZN723)

Catalog Number: BYT-ORB3009149
Article Name: Recombinant Human Zinc finger protein 723 (ZN723)
Biozol Catalog Number: BYT-ORB3009149
Supplier Catalog Number: orb3009149
Alternative Catalog Number: BYT-ORB3009149-1, BYT-ORB3009149-100, BYT-ORB3009149-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Zinc finger protein 723 ZNF723
This Recombinant Human Zinc finger protein 723 (ZN723) spans the amino acid sequence from region 1-513. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPD5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGPLTFTDVAIKFSLEEWQFLDTAQQNLYRDVMLENYRNLVFLGVGVSKPDLITCLEQGKEPWNMKRHKMVAKPPVVCSHFAQDLWPEQGIKDSFQKVILRSYGKYGHDNLQLRKGCESVDECKMHKGGYDELKQCLTTTPSKIFQCDKYVKVFHKFSSSNSQKIRHTGNNSFKCKECGKSFCMLSHLTKHERNHTRVNCYKCEECGKAFSVPSKLNNHKRIHTGEKPYKCEECGKAFNVSSSLNNHKRIHTGEK
Application Notes: Biological Origin: Homo sapiens (Human)