Recombinant Human Putative uncharacterized protein SNHG28 (SNH28)

Catalog Number: BYT-ORB3009150
Article Name: Recombinant Human Putative uncharacterized protein SNHG28 (SNH28)
Biozol Catalog Number: BYT-ORB3009150
Supplier Catalog Number: orb3009150
Alternative Catalog Number: BYT-ORB3009150-1, BYT-ORB3009150-100, BYT-ORB3009150-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative uncharacterized protein SNHG28, Small nucleolar RNA host gene 2, VSIG8 overlapping transcript protein, VSIG8-OT1, SNHG28 C1orf204
This Recombinant Human Putative uncharacterized protein SNHG28 (SNH28) spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPA3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGMLAPGPLQGRRPRKGHKGQEDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVTLASGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Application Notes: Biological Origin: Homo sapiens (Human)