Recombinant Human Putative protein T-ENOL (ENOL)

Product Overview

• Article Name: Recombinant Human Putative protein T-ENOL (ENOL)
• Biozol Catalog Number: BYT-ORB3009154
• Supplier Catalog Number: orb3009154
• Alternative Catalog Number: BYT-ORB3009154-1, BYT-ORB3009154-100, BYT-ORB3009154-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Putative protein T-ENOL, CDIP transferase opposite strand, pseudogene, CDIPT antisense RNA 1, CDIPTOSP CDIPT-AS1 T-ENOL

Product Description

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DO92
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)